Welcome to Amitecsa Store
Español Language
English English
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categorias
Carrito de compras
0
Product Details
Google Chromecast HD 4ta Generación
Notify me when product is back in stock

Google Chromecast HD 4ta Generación

Product Code: VCZ6NWi
Brand: Google
Product Condition: nuevo
Units in Stock: 0
$45.00 IVA incluido
 Add to Cart
Description
El entretenimiento que te gusta, con la ayuda de Google.

Reproduce tu contenido favorito en un increíble en 1080p con HDR.1
Explora tu contenido de entretenimiento en un mismo lugar.4
Reproduce en streaming todo lo que quieras o juega a videojuegos.
Reproduce en streaming todo lo que quieras, únete en directo o juega a videojuegos.4
Haz más cosas con tu televisor y contrólalo con tu voz.
Diseñado pensando en tu hogar y en el planeta.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
articulo añadido a la cesta
x

-------- ó --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i