Welcome to Amitecsa Store
Español Language
English English
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categorias
Carrito de compras
0

Memorias MicroSD

7 Producto(s) encontrados "Memorias MicroSD"
Memoria MicroSD SanDisk de 64GB
Oferta
Memoria MicroSD SanDisk de 64GB
MicroSD SanDisk de 64GB Clase 10 Incluye adaptador de tarjetas micro SD Original TOMA MEJORES FOTOS Y VIDEOS Captura y guarda más fotos de alta calidad y videos full HD en tu tableta o teléfono inteligente Android con las tarjetas SanDisk Ultra microSD UHS-I. Con capacidades de almacenamiento de hasta...
$9.00 $6.00
Detalles Añadir al carrito
articulo añadido a la cesta
x

-------- ó --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i